H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000195931_05 Accession number: M60333 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: MHC cell surface glycoprotein; Major histocompatibility complex, class II, DR alpha; Precursor;
 
 

Motif information
ORF

length(229),orf(28:717)
MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFD
FDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTK
RSNYTPITNDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHY
LPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLT
VGLVGIIIGTIFIIKGLRKSNAAERRGPL*
a.a.
length
InterPro Name
length(84), motif(26:109) 84 IPR011162 MHC classes I/II-like antigen recognition protein [Domain]
length(79), motif(28:106) 79 IPR014745 MHC class II, alpha/beta chain, N-terminal [Domain]
length(81), motif(29:109) 81 IPR001003 MHC class II, alpha chain, N-terminal [Domain]
length(80), motif(30:109) 80 IPR001003 MHC class II, alpha chain, N-terminal [Domain]
length(64), motif(110:173) 64 IPR003597 Immunoglobulin C1-set [Domain]
length(87), motif(111:197) 87 IPR013783 Immunoglobulin-like fold [Domain]
length(64), motif(111:174) 64 IPR003597 Immunoglobulin C1-set [Domain]
length(7), motif(161:167) 7 IPR003006 Immunoglobulin/major histocompatibility complex, conserved site [Conserved_site]