H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000195931_05 Accession number: M60333 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: MHC cell surface glycoprotein; Major histocompatibility complex, class II, DR alpha; Precursor;
 
 

Transcript original information
Accession number M60333.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (HLA-DRA) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (HLA-DRA);
Sequence data provider NA
Annotation project NA
Length of cDNA 744[bp] (No. of exon:4)[A:191 T:177 G:198 C:178]
Devision NA
Molecular type NA
Library origin Cell type B-lymphoblastoid
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGAAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0033491
Genomic location  G-integra Help Chromosome 6_cox_hap2
Location NA
Position 3878156- 3882154
Strand +
Possible duplicated location(s) HIX0078236; 
Gene structure 4 exon(s)
Database links RefSeq NM_019111
Ensembl ENST00000383127ENST00000434866ENST00000459705ENST00000461633ENST00000462200ENST00000481943ENST00000482781ENST00000493431ENST00000498597ENST00000542549
Entrez Gene Entrez Gene ID:3122
KEGG GENES KEGG GENES(3122)
GeneCard GeneCardHLA-DRA*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000028572
Predicted CDS 28..717;  229[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.792
Database links RefSeq NA
UniProt Q30118
CCDS NA

Motif information
ORF

length(229),orf(28:717)
MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFD
FDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTK
RSNYTPITNDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHY
LPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLT
VGLVGIIIGTIFIIKGLRKSNAAERRGPL*
a.a.
length
InterPro Name
length(84), motif(26:109) 84 IPR011162 MHC classes I/II-like antigen recognition protein [Domain]
length(79), motif(28:106) 79 IPR014745 MHC class II, alpha/beta chain, N-terminal [Domain]
length(81), motif(29:109) 81 IPR001003 MHC class II, alpha chain, N-terminal [Domain]
length(80), motif(30:109) 80 IPR001003 MHC class II, alpha chain, N-terminal [Domain]
length(64), motif(110:173) 64 IPR003597 Immunoglobulin C1-set [Domain]
length(87), motif(111:197) 87 IPR013783 Immunoglobulin-like fold [Domain]
length(64), motif(111:174) 64 IPR003597 Immunoglobulin C1-set [Domain]
length(7), motif(161:167) 7 IPR003006 Immunoglobulin/major histocompatibility complex, conserved site [Conserved_site]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000195931_05
H-Inv cluster ID Locus viewHIX0033491
Accession number M60333.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition MHC cell surface glycoprotein; Major histocompatibility complex, class II, DR alpha; Precursor;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q30118)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 2212658ALL
Gene family/group Gene family H-Inv gene family/group ID HIF0000002
Gene family/group name Major histocompatibility complex (MHC).
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol HLA-DRA
HGNC aliases NA
HGNC name major histocompatibility complex, class II, DR alpha
DDBJ HLA-DRA
UniProt HLA-DRA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000028572
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NM_019111
Ensembl ENST00000383127ENST00000434866ENST00000459705ENST00000461633ENST00000462200ENST00000481943ENST00000482781ENST00000493431ENST00000498597ENST00000542549
Entrez Gene Entrez Gene ID:3122
KEGG GENES KEGG GENES(3122)
GeneCard GeneCardHLA-DRA*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene family Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Biological process antigen processing and presentation (GO:0019882);  immune response (GO:0006955); 
Cellular component membrane (GO:0016020);  MHC class II protein complex (GO:0042613); 

Subcellular localization information  Last modified:26-Mar-2013
WoLF PSORT extracellular;  endoplasmic; 
Target P signal peptide
SOSUI membrane protein
TMHMM membrane protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.