H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000191957 Accession number: L09096 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Immunoglobulin V-set domain containing protein.
 
 

Transcript original information
Accession number L09096.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider NA
Annotation project NA
Length of cDNA 390[bp] (No. of exon:0)[A:87 T:93 G:115 C:95]
Devision HUM
Molecular type mRNA
Library origin Cell type B-cell
Tissue type bone marrow
Develpmental stage adult
Mini-G
Sequence quality information
CDS feature N/C-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0159199
Genomic location  G-integra Help Chromosome UM
Location NA
Position NA
Strand NA
Possible duplicated location(s) NA
Gene structure  exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene NA
KEGG GENES NA
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra;  cDNA-genome alignment; 

Predicted CDS information
HIP ID HIP000186122
Predicted CDS 1..390;  130[aa];  Orientation:+1; 
Codon Adaptation Index (CAI).

Motif information
ORF

length(130),orf(1:390)
LEESGGGLVKPGGSLRLSCESSGFTFTNAWMTWVRQSPGKGLEWVASIKS
KFDGGSPHYAAPVEGRFTISRNDLEDKLFLEMSGLKAEDTGVYYCATKYP
RYSDMMAGVRNHFYMDVWGKGTTVIVSSAS
a.a.
length
InterPro Name
length(128), motif(1:128) 128 IPR013783 Immunoglobulin-like fold [Domain]
length(95), motif(1:95) 95 IPR007110 Immunoglobulin-like [Domain]
length(124), motif(4:127) 124 IPR003599 Immunoglobulin subtype [Domain]
length(120), motif(7:126) 120 IPR013106 Immunoglobulin V-set [Domain]
length(84), motif(14:97) 84 IPR003596 Immunoglobulin V-set, subgroup [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000191957
H-Inv cluster ID Locus viewHIX0159199
Accession number L09096.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Immunoglobulin V-set domain containing protein.
Similarity category  Help Category: IPR domain containing protein(Category III).
InterPro domain (IPR013106) -containing protein.
Experimental evidence NA
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ NA
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000186122
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene NA
KEGG GENES NA
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases; 
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA


Subcellular localization information  Last modified:26-Mar-2013
WoLF PSORT cytosol;  nuclear;  extracellular; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.