H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000033559 Accession number: BC007964 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: ADP-ribosyl cyclase 1.
 
 

Transcript original information
Accession number BC007964.2
CAGE tag ID NA
EST ID NA
Clone Number MGC:14106 IMAGE:4309086
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (CD38) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (CD38);
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 1225[bp] (No. of exon:8)[A:343 T:308 G:284 C:290]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Primary B-Cells from Tonsils
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 1207(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0004113
Genomic location  G-integra Help Chromosome 4
Location 4p15.32
Position 15779990- 15850481
Strand +
Possible duplicated location(s) NA
Gene structure 8 exon(s)
Database links RefSeq NM_001775
Ensembl ENST00000226279ENST00000502843ENST00000506191ENST00000510674ENST00000511430ENST00000540195
Entrez Gene Entrez Gene ID:952
KEGG GENES KEGG GENES(952)
GeneCard GeneCardCD38*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000030599
Predicted CDS 49..951;  300[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.752
Database links RefSeq NP_001766
UniProt P28907
CCDS CCDS3417

Motif information
ORF

length(300),orf(49:951)
MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLAVVVPRWRQQW
SGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCN
ITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLL
GYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAA
CDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDS
RDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEI
*
a.a.
length
InterPro Name
length(285), motif(16:300) 285 IPR003193 ADP-ribosyl cyclase (CD38/157) [Family]
length(241), motif(56:296) 241 IPR003193 ADP-ribosyl cyclase (CD38/157) [Family]
length(97), motif(201:297) 97 IPR016040 NAD(P)-binding domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000033559
H-Inv cluster ID Locus viewHIX0004113
Accession number BC007964.2
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition ADP-ribosyl cyclase 1.
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (NP_001766)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID HIF0003136
Gene family/group name ADP-ribosyl cyclase (CD38/157) (IPR003193).
Evidence motif (InterPro) ID IPR003193
Gene symbol/name HGNC symbol CD38
HGNC aliases "CD38 antigen (p45)"
HGNC name CD38 molecule
DDBJ CD38
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000030599
No. of interaction 5
Interaction partner(s) HIP000055075HIP000081399HIP000087381HIP000089574HIP000115321
BIND 178044; 
DIP NA
MINT NA
HPRD 00880;  00903;  01080;  01425;  01740; 
IntAct NA
Database links RefSeq NM_001775
Ensembl ENST00000226279ENST00000502843ENST00000506191ENST00000510674ENST00000511430ENST00000540195
Entrez Gene Entrez Gene ID:952
KEGG GENES KEGG GENES(952)
GeneCard GeneCardCD38*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links ADP-ribosyl cyclase (CD38/157) (IPR003193). Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function catalytic activity (GO:0003824);  binding (GO:0005488);  NAD+ nucleosidase activity (GO:0003953); 
Biological process metabolic process (GO:0008152); 

Subcellular localization information  Last modified:26-Mar-2013
WoLF PSORT cytosol;  plasma membrane;  extracellular;  Other; 
Target P Not predicted
SOSUI membrane protein
TMHMM membrane protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:26-Mar-2013
Start End PDB_ID E-value Identity Coverage SCOP_ID
45 291 2ef1A1 e-114 99.6 247/247 c.23.14.3
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:26-Mar-2013
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA220701; 
Affymetrix
GeneChip
HG-Focus 205692_s_at; 
HG-U133 205692_s_at; 
HG-U133A 205692_s_at; 
HG-U133A_2 205692_s_at; 
HG-U133B NA
HG-U133_Plus_2 205692_s_at; 
HG-U95 40323_at; 
HG-U95A 40323_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2719672;  2719678;  2719679;  2719686;  2719689;  2719692;  2719693;  2719694;  2719695;  2761815; 
HuGeneFL D84276_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P167328; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P167328; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:26-Mar-2013
Disease relation Disease name:NA
Related information in OMIM OMIM ID:NA Title:NA
Co-localized orphan diseases OMIM ID:  603663603783605480609456611637611863612335
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(952)
Disease Entrez Gene ID:(952)
Substance Entrez Gene ID:(952)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
71 .. 71 C/T rs78988986 + CDS Nonsynonymous[Pro8Leu]
193 .. 193 C/G rs77549972 + CDS Nonsynonymous[Gln49Glu]
206 ^ 207 -/G rs35432563 + CDS
258 .. 258 C/T rs78580781 + CDS Synonymous[Tyr70Tyr]
466 .. 466 C/T rs1800561 + CDS Nonsynonymous[Arg140Trp]
552 .. 552 A/C rs1800051 + CDS Synonymous[Ile168Ile]
620 .. 620 C/T rs75935397 + CDS Nonsynonymous[Thr191Met]
969 .. 969 T/G rs77530647 + 3'UTR
1005 .. 1005 T/G rs80143490 + 3'UTR
1020 .. 1020 A/T rs80225519 + 3'UTR
1043 .. 1043 T/C rs113119391 + 3'UTR
1055 .. 1055 C/T rs75472406 + 3'UTR
1056 .. 1056 T/G rs1803404 + 3'UTR
1081 .. 1081 C/T rs76652758 + 3'UTR
1108 .. 1108 A/G rs74914520 + 3'UTR
1125 .. 1125 G/A rs74856947 + 3'UTR
1139 .. 1139 T/C rs79224521 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer