H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000021733 Accession number: AK096878 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Transcription cofactor vestigial-like protein 2 isoform 1.
 
 

Transcript original information
Accession number AK096878.1
CAGE tag ID NA
EST ID NA
Clone Number SKMUS2000701
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (VGLL2) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (VGLL2);
Sequence data provider Project:FLJ; Provider:FLJ/HRI; 
Annotation project H-Invitational FLcDNA
Length of cDNA 1161[bp] (No. of exon:4)[A:215 T:191 G:314 C:441]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type skeletal muscle
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0006170
Genomic location  G-integra Help Chromosome 6
Location 6q22.1
Position 117586904- 117593832
Strand +
Possible duplicated location(s) NA
Gene structure 4 exon(s)
Database links RefSeq NM_153453NM_182645
Ensembl ENST00000326274ENST00000352536
Entrez Gene Entrez Gene ID:245806
KEGG GENES KEGG GENES(245806)
GeneCard GeneCardVGLL2*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000096250
Predicted CDS 24..977;  317[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.786
Database links RefSeq NP_872586
UniProt Q8N8G2
CCDS CCDS5115

Motif information
ORF

length(317),orf(24:977)
MSCLDVMYQVYGPPQPYFAAAYTPYHQKLAYYSKMQEAQECNASPSSSGS
GSSSFSSQTPASIKEEEGSPEKERPPEAEYINSRCVLFTYFQGDISSVVD
EHFSRALSQPSSYSPSCTSSKAPRSSGPWRDCSFPMSQRSFPASFWNSAY
QAPVPPPLGSPLATAHSELPFAAADPYSPAALHGHLHQGATEPWHHAHPH
HAHPHHPYALGGALGAQAAPYPRPAAVHEVYAPHFDPRYGPLLMPAASGR
PARLATAPAPAPGSPPCELSGKGEPAGAAWAGPGGPFASPSGDVAQGLGL
SVDSARRYSLCGASLLS*
a.a.
length
InterPro Name
length(33), motif(79:111) 33 IPR011520 Vestigial/tondu [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000021733
H-Inv cluster ID Locus viewHIX0006170
Accession number AK096878.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Transcription cofactor vestigial-like protein 2 isoform 1.
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (NP_872586)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol VGLL2
HGNC aliases NA
HGNC name vestigial like 2 (Drosophila)
DDBJ NA
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000096250
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NM_153453NM_182645
Ensembl ENST00000326274ENST00000352536
Entrez Gene Entrez Gene ID:245806
KEGG GENES KEGG GENES(245806)
GeneCard GeneCardVGLL2*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function transcription regulator activity (GO:0030528); 
Biological process regulation of transcription (GO:0045449); 
Cellular component nucleus (GO:0005634); 

Subcellular localization information  Last modified:26-Mar-2013
WoLF PSORT nuclear;  cytosol; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:26-Mar-2013
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus NA
HG-U133 NA
HG-U133A NA
HG-U133A_2 NA
HG-U133B NA
HG-U133_Plus_2 NA
HG-U95 NA
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2922942;  2922943;  2922947;  2922951;  2922952;  2971258; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 A_32_P459849; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:26-Mar-2013
Disease relation Disease name:NA
Related information in OMIM OMIM ID:NA Title:NA
Co-localized orphan diseases OMIM ID:  122550143400604519608545610294611724612558
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(245806)
Disease Entrez Gene ID:(245806)
Substance Entrez Gene ID:(245806)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
122 .. 122 C/A rs61746898 + CDS Synonymous[Ser33Ser]
185 .. 185 A/C rs79582565 + CDS Synonymous[Ser54Ser]
250 .. 250 C/A rs41291916 + CDS Nonsynonymous[Pro76Gln]
278 .. 278 C/T rs35052255 - CDS Synonymous[Cys85Cys]
464 .. 464 T/C rs13194610 + CDS Synonymous[Asn147Asn]
1112 .. 1112 C/A rs76963111 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer