H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000013556 Accession number: AK056942 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: E3 ubiquitin-protein ligase TRIM63.
 
 

Motif information
ORF

length(353),orf(137:1198)
MDYKSSLIQDGNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCAND
IFQAANPYWTSRGSSVSMSGGRFRCPTCRHEVIMDRHGVYGLQRNLLVEN
IIDIYKQECSSRPLQKGSHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGI
HKACEVAPLQSVFQGQKTELNNCISMLVAGNDRVQTIITQLEDSRRVTKE
NSHQVKEELSQKFDTLYAILDEKKSELLQRITQEQEKKLSFIEALIQQYQ
EQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQ
GFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEE
GHQ*
a.a.
length
InterPro Name
length(120), motif(10:129) 120 IPR013083 Zinc finger, RING/FYVE/PHD-type [Domain]
length(56), motif(23:78) 56 IPR018957 Zinc finger, C3HC4 RING-type [Domain]
length(56), motif(23:78) 56 IPR001841 Zinc finger, RING-type [Domain]
length(57), motif(23:79) 57 IPR001841 Zinc finger, RING-type [Domain]
length(10), motif(39:48) 10 IPR017907 Zinc finger, RING-type, conserved site [Conserved_site]
length(43), motif(117:159) 43 IPR000315 Zinc finger, B-box [Domain]
length(33), motif(120:152) 33 IPR000315 Zinc finger, B-box [Domain]
length(59), motif(267:325) 59 IPR017903 COS domain [Domain]