H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000000461 Accession number: AB018279 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Synaptic vesicle glycoprotein 2A.
 
 

Motif information
ORF

length(742),orf(435:2663)
MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFE
EEDDDDDFPAPSDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQG
IPRAESGGKGERMADGAPLAGVRGGLSDGEGPPGGRGEAQRRKEREELAQ
QYEAILRECGHGRFQWTLYFVLGLALMADGVEVFVVGFVLPSAEKDMCLS
DSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSS
FVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFW
MIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVFAIGA
LTTQPESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTI
HQEDELIEIQSDTGTWYQRWGVRALSLGGQVWGNFLSCFGPEYRRITLMM
MGVWFTMSFSYYGLTVWFPDMIRHLQAVDYASRTKVFPGERVEHVTFNFT
LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT
FINTVFYNTDLFEYKFVNSRLINSTFLHNKEGCPLDVTGTGEGAYMVYFV
SFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSESA
MIALLCLFGGVSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLG
ISIFTSFVGITKAAPILFASAALALGSSLALKLPETRGQVLQ*
a.a.
length
InterPro Name
length(742), motif(1:742) 742 IPR022308 Synaptic vesicle protein SV2, chordata [Family]
length(611), motif(132:742) 611 IPR005988 Synaptic vesicle protein SV2 [Family]
length(335), motif(140:474) 335 IPR016196 Major facilitator superfamily, general substrate transporter [Domain]
length(570), motif(168:737) 570 IPR020846 Major facilitator superfamily [Domain]
length(281), motif(193:473) 281 IPR005828 General substrate transporter [Family]
length(26), motif(264:289) 26 IPR005829 Sugar transporter, conserved site [Conserved_site]
length(152), motif(591:742) 152 IPR016196 Major facilitator superfamily, general substrate transporter [Domain]
length(124), motif(600:723) 124 IPR011701 Major facilitator superfamily MFS-1 [Family]