H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000000461 Accession number: AB018279 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Synaptic vesicle glycoprotein 2A.
 
 

Transcript original information
Accession number AB018279.1
CAGE tag ID NA
EST ID NA
Clone Number hk03846
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (SV2A) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (SV2A);
Sequence data provider Provider:KDRI
Annotation project H-Invitational FLcDNA
Length of cDNA 4353[bp] (No. of exon:13)[A:914 T:1066 G:1192 C:1181]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type brain
Develpmental stage adult
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) GAGCAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0001006
Genomic location  G-integra Help Chromosome 1
Location 1q21.2
Position 149874876- 149889377
Strand -
Possible duplicated location(s) NA
Gene structure 13 exon(s)
Database links RefSeq NM_014849
Ensembl ENST00000369145ENST00000369146
Entrez Gene Entrez Gene ID:9900
KEGG GENES KEGG GENES(9900)
GeneCard GeneCardSV2A*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000045445
Predicted CDS 435..2663;  742[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.8
Database links RefSeq NP_055664
UniProt Q7L0J3
CCDS CCDS940

Motif information
ORF

length(742),orf(435:2663)
MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFE
EEDDDDDFPAPSDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQG
IPRAESGGKGERMADGAPLAGVRGGLSDGEGPPGGRGEAQRRKEREELAQ
QYEAILRECGHGRFQWTLYFVLGLALMADGVEVFVVGFVLPSAEKDMCLS
DSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLSVNSVFAFFSS
FVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFW
MIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVFAIGA
LTTQPESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTI
HQEDELIEIQSDTGTWYQRWGVRALSLGGQVWGNFLSCFGPEYRRITLMM
MGVWFTMSFSYYGLTVWFPDMIRHLQAVDYASRTKVFPGERVEHVTFNFT
LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT
FINTVFYNTDLFEYKFVNSRLINSTFLHNKEGCPLDVTGTGEGAYMVYFV
SFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSESA
MIALLCLFGGVSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLG
ISIFTSFVGITKAAPILFASAALALGSSLALKLPETRGQVLQ*
a.a.
length
InterPro Name
length(742), motif(1:742) 742 IPR022308 Synaptic vesicle protein SV2, chordata [Family]
length(611), motif(132:742) 611 IPR005988 Synaptic vesicle protein SV2 [Family]
length(335), motif(140:474) 335 IPR016196 Major facilitator superfamily, general substrate transporter [Domain]
length(570), motif(168:737) 570 IPR020846 Major facilitator superfamily [Domain]
length(281), motif(193:473) 281 IPR005828 General substrate transporter [Family]
length(26), motif(264:289) 26 IPR005829 Sugar transporter, conserved site [Conserved_site]
length(152), motif(591:742) 152 IPR016196 Major facilitator superfamily, general substrate transporter [Domain]
length(124), motif(600:723) 124 IPR011701 Major facilitator superfamily MFS-1 [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000000461
H-Inv cluster ID Locus viewHIX0001006
Accession number AB018279.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Synaptic vesicle glycoprotein 2A.
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (NP_055664)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID HIF0001932
Gene family/group name Synaptic vesicle protein SV2 (IPR005988).
Evidence motif (InterPro) ID IPR005988
Gene symbol/name HGNC symbol SV2A
HGNC aliases NA
HGNC name synaptic vesicle glycoprotein 2A
DDBJ KIAA0736
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000045445
No. of interaction 2
Interaction partner(s) HIP000028960HIP000066044
BIND NA
DIP NA
MINT NA
HPRD 01260;  03020; 
IntAct EBI-2689629; 
Database links RefSeq NM_014849
Ensembl ENST00000369145ENST00000369146
Entrez Gene Entrez Gene ID:9900
KEGG GENES KEGG GENES(9900)
GeneCard GeneCardSV2A*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Synaptic vesicle protein SV2 (IPR005988). Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function transporter activity (GO:0005215); 
Biological process transport (GO:0006810); 
Cellular component integral to membrane (GO:0016021);  membrane (GO:0016020); 

Subcellular localization information  Last modified:26-Mar-2013
WoLF PSORT plasma membrane; 
Target P Other
SOSUI membrane protein
TMHMM membrane protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:26-Mar-2013
Start End PDB_ID E-value Identity Coverage SCOP_ID
501 587 2bm4A1 3e-10 11.5 87/180 b.80.8.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:26-Mar-2013
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA241422; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 NA
HG-U133A NA
HG-U133A_2 NA
HG-U133B NA
HG-U133_Plus_2 NA
HG-U95 NA
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2434140;  2434141;  2434143;  2434145;  2434147;  2434148;  2434149;  2434150;  2434151;  2434152;  2434154;  2434155;  2434156;  2434157; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 A_24_P131236; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:26-Mar-2013
Disease relation Disease name:NA
Related information in OMIM OMIM ID:NA Title:NA
Co-localized orphan diseases OMIM ID:  115665116600155600600975605225605606606788606852606928607317607671608543608553608995610320612367612596
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(9900)
Disease Entrez Gene ID:(9900)
Substance Entrez Gene ID:(9900)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Evolutionary information  Evola Help Last modified:26-Mar-2013
Relationship Species Accession number MGI Links
Orthology Macaca sp. (Macaque) AB169771 G-integraG-integra
Orthology Mus sp. (Mouse) AK080525 MGI:2408387 G-integraG-integra
Orthology Bos sp. (Cow) BC123478 G-integraG-integra
Orthology Danio sp. (Zebrafish) BC133144 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) CR670677 G-integraG-integra
Orthology Canis sp. (Dog) ENSCAFT00000018412 G-integraG-integra
Orthology Monodelphis sp. (Opossum) ENSMODT00000023813 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000003856 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000020400 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000001101 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) GSTENT00017382001 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) GSTENT00019515001 G-integraG-integra
Orthology Rattus sp. (Rat) L05435 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000127636 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000138746 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XM_001166824 G-integraG-integra
Orthology Equus sp. (Horse) XM_001488584 G-integraG-integra
Orthology Danio sp. (Zebrafish) XM_691342 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
39 .. 39 G/A rs12131104 - 5'UTR
96 .. 96 A/C rs115160215 - 5'UTR
102 .. 102 G/T rs76103664 - 5'UTR
214 .. 214 C/A rs74124086 - 5'UTR
244 .. 244 C/T rs577935 - 5'UTR
325 .. 325 A/T rs3754045 - 5'UTR
340 .. 340 G/A rs41264628 - 5'UTR
1105 .. 1105 G/T rs61807545 - CDS Nonsynonymous[Gly224Val]
1427 .. 1427 C/T rs11542469 + CDS Synonymous[His331His]
1764 .. 1764 C/T rs117711516 - CDS Nonsynonymous[Arg444Trp]
1772 .. 1772 C/T rs73006313 - CDS Synonymous[Ile446Ile]
1999 .. 1999 A/G rs111800602 - CDS Nonsynonymous[Lys522Arg]
2192 .. 2192 C/T rs73006309 - CDS Synonymous[Asp586Asp]
2361 .. 2361 T/A rs1801870 + CDS Nonsynonymous[Ser643Thr]
2543 .. 2543 C/T rs7518476 - CDS Synonymous[Ile703Ile]
2564 .. 2564 C/T rs13067 + CDS Synonymous[Ile710Ile]
2859 .. 2859 T/A rs28642307 - 3'UTR
2967 ^ 2968 -/C rs35497808 - 3'UTR
2998 .. 2998 C/T rs41264606 - 3'UTR
3105 .. 3105 A/G rs7534365 - 3'UTR
3847 .. 3847 T/C rs78146458 - 3'UTR
3956 .. 3956 T/G rs113652558 - 3'UTR
3973 .. 3973 A/T rs61807542 - 3'UTR
4049 .. 4049 G/A rs41264604 - 3'UTR
4050 ^ 4051 -/A rs35818770 - 3'UTR
4127 ^ 4128 -/C rs34296875 - 3'UTR
4228 .. 4228 G/A rs3820447 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer